PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA27552
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 363aa    MW: 40163.4 Da    PI: 4.547
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA27552genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.51.8e-34149203155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                kpr+rWtpeLHe+Fveav+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Tp57577_TGAC_v2_mRNA27552 149 KPRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMKVEGLTIYHVKSHLQKYRT 203
                                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.597146206IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-32146205IPR009057Homeodomain-like
SuperFamilySSF466895.73E-18147203IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-25149203IPR006447Myb domain, plants
PfamPF002496.3E-10151202IPR001005SANT/Myb domain
PfamPF143791.2E-20236280IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MSSSYPSSSM QAASINSNIR SVGHMFSTSA DQLPDNVPFA SASEIHSTPF PQESDVLSWG  60
TDPFDDILQF PDAPIQNDHV EYSGSDVLGG NAKITDFKEW VDQLMSVDES PQPNWNELLS  120
DNNIAEQYVP SKEVNGLPNS SVSTTSQSKP RMRWTPELHE AFVEAVNQLG GSEKATPKGV  180
LNLMKVEGLT IYHVKSHLQK YRTARYKPEP SEGIEEKKLT SIDEMTTIDL KTPKGITEAL  240
RLQMELQKRL HEQLEIQRNL QIQIENQGKH LQMMFEQQIK SNDPSAPLSS VVAPPTVENL  300
ENKNEGHEKL GTNGSTPDNK SEGSSQDTST KQKGDDAKVT DELELEEGQF VAPPSKRAKT  360
DE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003590977.10.0myb-like transcription factor family protein
SwissprotQ8GUN54e-78PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLG7I6T30.0G7I6T3_MEDTR; Myb-like transcription factor family protein
STRINGGLYMA03G41040.31e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.33e-79G2-like family protein